Lineage for d1wd4a1 (1wd4 A:19-337)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390181Family b.29.1.21: Alpha-L-arabinofuranosidase B, N-terminal domain [110143] (2 proteins)
    automatically mapped to Pfam PF09206
  6. 2390182Protein Alpha-L-arabinofuranosidase B, N-terminal domain [110144] (1 species)
  7. 2390183Species Aspergillus kawachii [TaxId:40384] [110145] (2 PDB entries)
    Uniprot Q8NK89 19-499
  8. 2390185Domain d1wd4a1: 1wd4 A:19-337 [109235]
    Other proteins in same PDB: d1wd4a2
    complexed with ahr

Details for d1wd4a1

PDB Entry: 1wd4 (more details), 2.07 Å

PDB Description: crystal structure of arabinofuranosidase complexed with arabinose
PDB Compounds: (A:) alpha-L-arabinofuranosidase B

SCOPe Domain Sequences for d1wd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd4a1 b.29.1.21 (A:19-337) Alpha-L-arabinofuranosidase B, N-terminal domain {Aspergillus kawachii [TaxId: 40384]}
gpcdiyeagdtpcvaahsttralyssfsgalyqlqrgsddttttispltaggiadasaqd
tfcanttclitiiydqsgngnhltqappggfdgpdtdgydnlasaigapvtlngqkaygv
fmspgtgyrnneatgtatgdeaegmyavldgthyndaccfdygnaetsstdtgaghmeai
ylgnsttwgygagdgpwimvdmennlfsgadegynsgdpsisyrfvtaavkggadkwair
ganaasgslstyysgarpdysgynpmskegaiilgiggdnsngaqgtfyegvmtsgypsd
dtensvqenivaakyvvgs

SCOPe Domain Coordinates for d1wd4a1:

Click to download the PDB-style file with coordinates for d1wd4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wd4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wd4a2