Lineage for d1wd2a_ (1wd2 A:)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1465026Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 1465027Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 1465028Family g.44.1.1: RING finger domain, C3HC4 [57851] (14 proteins)
  6. 1465032Protein Ariadne-1 protein homolog [111459] (1 species)
  7. 1465033Species Human (Homo sapiens) [TaxId:9606] [111460] (1 PDB entry)
    Uniprot Q9Y4X5 336-394
  8. 1465034Domain d1wd2a_: 1wd2 A: [109232]
    complexed with zn

Details for d1wd2a_

PDB Entry: 1wd2 (more details)

PDB Description: solution structure of the c-terminal ring from a ring-ibr-ring (triad) motif
PDB Compounds: (A:) Ariadne-1 protein homolog

SCOPe Domain Sequences for d1wd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wd2a_ g.44.1.1 (A:) Ariadne-1 protein homolog {Human (Homo sapiens) [TaxId: 9606]}
wiaantkecpkchvtiekdggcnhmvcrnqnckaefcwvclgpwephgsawyncnrynef

SCOPe Domain Coordinates for d1wd2a_:

Click to download the PDB-style file with coordinates for d1wd2a_.
(The format of our PDB-style files is described here.)

Timeline for d1wd2a_: