Lineage for d1w7aa1 (1w7a A:270-566)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278436Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1278437Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 1278438Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 1278439Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 1278440Species Escherichia coli [TaxId:562] [48338] (10 PDB entries)
    Uniprot P23909 2-800
  8. 1278442Domain d1w7aa1: 1w7a A:270-566 [109218]
    Other proteins in same PDB: d1w7aa2, d1w7aa3, d1w7aa4, d1w7ab2, d1w7ab3, d1w7ab4
    complexed with atp, mg

Details for d1w7aa1

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1w7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7aa1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1w7aa1:

Click to download the PDB-style file with coordinates for d1w7aa1.
(The format of our PDB-style files is described here.)

Timeline for d1w7aa1: