Lineage for d1w7aa1 (1w7a A:270-566)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447287Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 447288Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 447289Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 447290Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 447291Species Escherichia coli [TaxId:562] [48338] (7 PDB entries)
  8. 447294Domain d1w7aa1: 1w7a A:270-566 [109218]
    Other proteins in same PDB: d1w7aa2, d1w7aa3, d1w7aa4, d1w7ab2, d1w7ab3, d1w7ab4

Details for d1w7aa1

PDB Entry: 1w7a (more details), 2.27 Å

PDB Description: atp bound muts

SCOP Domain Sequences for d1w7aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w7aa1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1w7aa1:

Click to download the PDB-style file with coordinates for d1w7aa1.
(The format of our PDB-style files is described here.)

Timeline for d1w7aa1: