SCOP 1.71: Domain d1w3id_: 1w3i D:

Lineage for d1w3id_ (1w3i D:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (6 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (12 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [110361] (4 PDB entries)

8. Domain d1w3id_: 1w3i D: [109155]
   complexed with gol, pyr

Details for d1w3id_

PDB Entry: 1w3i, 1.7 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with pyruvate

SCOP Domain Sequences for d1w3id_:

Sequence; same for both SEQRES and ATOM records:

>d1w3id_ c.1.10.1 (D:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

Timeline for d1w3id_:

• d1w3id_ first appeared in SCOP 1.69
  
• d1w3id_ appears in SCOP 1.73
  
• d1w3id_ appears in the current release, SCOPe 2.08