SCOP 1.73: Domain d1w39c_: 1w39 C:

Lineage for d1w39c_ (1w39 C:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (2 PDB entries)

8. Domain d1w39c_: 1w39 C: [109148]

Details for d1w39c_

PDB Entry: 1w39, 3.75 Å

PDB Description: crystal structure of an artificial top component of turnip yellow mosaic virus

PDB Compounds: (C:) turnip yellow mosaic virus empty capsid

SCOP Domain Sequences for d1w39c_:

Sequence; same for both SEQRES and ATOM records:

>d1w39c_ b.121.4.6 (C:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus) [TaxId: 12154]}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst

Timeline for d1w39c_:

• d1w39c_ first appeared in SCOP 1.69
  
• d1w39c_ appears in SCOP 1.71
  
• d1w39c_ appears in SCOP 1.75
  
• d1w39c_ appears in the current release, SCOPe 2.08