Lineage for d1w2fa_ (1w2f A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979411Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2979412Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies
  5. 2979475Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
    Pfam PF03770
  6. 2979476Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)
  7. 2979477Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
    Uniprot P23677 187-461
  8. 2979478Domain d1w2fa_: 1w2f A: [109125]
    complexed with so4

Details for d1w2fa_

PDB Entry: 1w2f (more details), 1.8 Å

PDB Description: human inositol (1,4,5)-trisphosphate 3-kinase substituted with selenomethionine
PDB Compounds: (A:) inositol-trisphosphate 3-kinase a

SCOPe Domain Sequences for d1w2fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2fa_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
mswvqlaghtgsfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesy
lqlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeh
aqravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqg
deevlrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpd
gqildhrrpweegnredgyllgldnligilaslaer

SCOPe Domain Coordinates for d1w2fa_:

Click to download the PDB-style file with coordinates for d1w2fa_.
(The format of our PDB-style files is described here.)

Timeline for d1w2fa_: