Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.143: SAICAR synthase-like [56103] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies |
Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins) Pfam PF03770 |
Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries) Uniprot P23677 187-461 |
Domain d1w2fa_: 1w2f A: [109125] complexed with so4 |
PDB Entry: 1w2f (more details), 1.8 Å
SCOPe Domain Sequences for d1w2fa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2fa_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]} mswvqlaghtgsfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesy lqlqdlldgfdgpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeeh aqravtkprymqwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqg deevlrrylnrlqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpd gqildhrrpweegnredgyllgldnligilaslaer
Timeline for d1w2fa_: