SCOPe 2.08: Domain d1w2da_: 1w2d A:

Lineage for d1w2da_ (1w2d A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.143: SAICAR synthase-like [56103] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.143.1: SAICAR synthase-like [56104] (4 families)
   shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies

5. Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins)
   Pfam PF03770

6. Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries)
   Uniprot P23677 187-461

8. Domain d1w2da_: 1w2d A: [109121]
   complexed with 4ip, adp, mn, so4

Details for d1w2da_

PDB Entry: 1w2d, 1.94 Å

PDB Description: human inositol (1,4,5)-trisphosphate 3-kinase complexed with mn2+/adp/ins(1,3,4,5)p4

PDB Compounds: (A:) inositol-trisphosphate 3-kinase a

SCOPe Domain Sequences for d1w2da_:

Sequence; same for both SEQRES and ATOM records:

>d1w2da_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]}
sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd
gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym
qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr
lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe
egnredgyllgldnligilaslaer

Timeline for d1w2da_:

• d1w2da_ first appeared in SCOP 1.69
  
• d1w2da_ appears in SCOPe 2.07