![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.143: SAICAR synthase-like [56103] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.143.1: SAICAR synthase-like [56104] (4 families) ![]() shares functional and structural similarities with the ATP-grasp fold and protein kinase superfamilies |
![]() | Family d.143.1.3: Inositol polyphosphate kinase (IPK) [111188] (2 proteins) Pfam PF03770 |
![]() | Protein Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A [111189] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [111190] (3 PDB entries) Uniprot P23677 187-461 |
![]() | Domain d1w2da_: 1w2d A: [109121] complexed with 4ip, adp, mn, so4 |
PDB Entry: 1w2d (more details), 1.94 Å
SCOPe Domain Sequences for d1w2da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w2da_ d.143.1.3 (A:) Inositol 1,4,5-trisphosphate 3-kinase A, IP3K A {Human (Homo sapiens) [TaxId: 9606]} sfkaagtsglilkrcseperyclarlmadalrgcvpafhgvverdgesylqlqdlldgfd gpcvldckmgvrtyleeeltkarerpklrkdmykkmlavdpeapteeehaqravtkprym qwregisssttlgfriegikkadgscstdfkttrsreqvlrvfeefvqgdeevlrrylnr lqqirdtlevseffrrhevigssllfvhdhchragvwlidfgkttplpdgqildhrrpwe egnredgyllgldnligilaslaer
Timeline for d1w2da_: