SCOP 1.75: Domain d1w16a_: 1w16 A:

Lineage for d1w16a_ (1w16 A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families)
   two constituent families are related by circular permutation

5. Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (10 proteins)
   topologically similar to the C-terminal domain of PapD

6. Protein Synaptotagmin IV [101562] (2 species)
   duplication: contains 2 C2 domains

7. Species Rat (Rattus norvegicus) [TaxId:10116] [110115] (2 PDB entries)
   Uniprot P50232 288-425

8. Domain d1w16a_: 1w16 A: [109042]
   second C2 domain
   complexed with cl, na

Details for d1w16a_

PDB Entry: 1w16, 2.3 Å

PDB Description: rat synaptotagmin 4 c2b domain in the absence of calcium

PDB Compounds: (A:) Synaptotagmin IV

SCOP Domain Sequences for d1w16a_:

Sequence, based on SEQRES records:

>d1w16a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]}
rgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnlyhakkriskkkthvkk
ctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlvlgataegsggghwke
icdfprrqiakwhmlcdg

Sequence, based on observed residues (ATOM records):

>d1w16a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]}
rgellvslcyqsttntltvvvlkarhlpsdpyvkvnlyhakkriskkkthvavfnelfvf
dipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfprrqiakwh
mlcdg

Timeline for d1w16a_:

• d1w16a_ first appeared in SCOP 1.69
  
• d1w16a_ appears in SCOP 1.73
  
• d1w16a_ appears in SCOPe 2.01
  
• d1w16a_ appears in the current release, SCOPe 2.08