Lineage for d1w16a_ (1w16 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 458377Fold b.7: C2 domain-like [49561] (4 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 458378Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (2 families) (S)
    two constituent families are related by circular permutation
  5. 458429Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (8 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 458458Protein Synaptotagmin IV [101562] (2 species)
    duplication: contains 2 C2 domains
  7. 458461Species Rat (Rattus norvegicus) [TaxId:10116] [110115] (2 PDB entries)
  8. 458463Domain d1w16a_: 1w16 A: [109042]

Details for d1w16a_

PDB Entry: 1w16 (more details), 2.3 Å

PDB Description: rat synaptotagmin 4 c2b domain in the absence of calcium

SCOP Domain Sequences for d1w16a_:

Sequence, based on SEQRES records: (download)

>d1w16a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus)}
rgellvslcyqsttntltvvvlkarhlpksdvsglsdpyvkvnlyhakkriskkkthvkk
ctpnavfnelfvfdipcesleeisveflvldsergsrnevigrlvlgataegsggghwke
icdfprrqiakwhmlcdg

Sequence, based on observed residues (ATOM records): (download)

>d1w16a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus)}
rgellvslcyqsttntltvvvlkarhlpsdpyvkvnlyhakkriskkkthvavfnelfvf
dipcesleeisveflvldsergsrnevigrlvlgataegsggghwkeicdfprrqiakwh
mlcdg

SCOP Domain Coordinates for d1w16a_:

Click to download the PDB-style file with coordinates for d1w16a_.
(The format of our PDB-style files is described here.)

Timeline for d1w16a_: