Lineage for d1vyub1 (1vyu B:38-174)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946224Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 946225Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 946518Protein SH3-like domain of the L-type calcium channel [110158] (2 species)
  7. 946519Species Norway rat (Rattus norvegicus) [TaxId:10116] [110160] (3 PDB entries)
    Uniprot P54287 38-362
  8. 946521Domain d1vyub1: 1vyu B:38-174 [108916]
    Other proteins in same PDB: d1vyua2, d1vyub2

Details for d1vyub1

PDB Entry: 1vyu (more details), 2.3 Å

PDB Description: beta3 subunit of voltage-gated ca2+-channel
PDB Compounds: (B:) calcium channel beta-3 subunit

SCOPe Domain Sequences for d1vyub1:

Sequence, based on SEQRES records: (download)

>d1vyub1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnpsslsdignrrspppsl
akqkqkqaehvppydvv

Sequence, based on observed residues (ATOM records): (download)

>d1vyub1 b.34.2.1 (B:38-174) SH3-like domain of the L-type calcium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
esarrevesqaqqqlerakhkpvafavrtnvsycgvldeecpvqgsgvnfeakdflhike
kysndwwigrlvkeggdiafipspqrlesirlkqeqkarrsgnhvppydvv

SCOPe Domain Coordinates for d1vyub1:

Click to download the PDB-style file with coordinates for d1vyub1.
(The format of our PDB-style files is described here.)

Timeline for d1vyub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vyub2