Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.3: Malic enzyme N-domain [53240] (2 proteins) Pfam PF00390; decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand |
Protein Malate oxidoreductase (malic enzyme) [110452] (1 species) |
Species Thermotoga maritima [TaxId:2336] [110453] (1 PDB entry) Uniprot Q9WZ12 |
Domain d1vl6c2: 1vl6 C:1-154 [108729] Other proteins in same PDB: d1vl6a1, d1vl6a3, d1vl6b1, d1vl6b3, d1vl6c1, d1vl6c3, d1vl6d1, d1vl6d3 Structural genomics target fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1vl6 (more details), 2.61 Å
SCOPe Domain Sequences for d1vl6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vl6c2 c.58.1.3 (C:1-154) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} vdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntv avvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksle psfgginledigapkcfrilqrlseemnipvfhd
Timeline for d1vl6c2: