PDB entry 1vl6

View 1vl6 on RCSB PDB site
Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution
Class: oxidoreductase
Keywords: TM0542, NAD-DEPENDENT MALIC ENZYME, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-07-13, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0542
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (12-387)
      • leader sequence (11)
      • see remark 999 (12)
      • see remark 999 (17)
      • modified residue (95)
      • modified residue (158)
      • modified residue (283)
      • modified residue (333)
      • modified residue (347)
      • modified residue (373)
    Domains in SCOPe 2.07: d1vl6a1, d1vl6a2, d1vl6a3
  • Chain 'B':
    Compound: Malate oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0542
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (12-387)
      • leader sequence (11)
      • see remark 999 (12)
      • see remark 999 (17)
      • modified residue (95)
      • modified residue (158)
      • modified residue (333)
      • modified residue (347)
      • modified residue (373)
    Domains in SCOPe 2.07: d1vl6b1, d1vl6b2, d1vl6b3
  • Chain 'C':
    Compound: Malate oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0542
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (12-387)
      • leader sequence (11)
      • see remark 999 (12)
      • see remark 999 (17)
      • modified residue (95)
      • modified residue (158)
      • modified residue (283)
      • modified residue (333)
      • modified residue (347)
      • modified residue (373)
    Domains in SCOPe 2.07: d1vl6c1, d1vl6c2, d1vl6c3
  • Chain 'D':
    Compound: Malate oxidoreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0542
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZ12 (12-387)
      • leader sequence (11)
      • see remark 999 (12)
      • see remark 999 (17)
      • modified residue (95)
      • modified residue (158)
      • modified residue (283)
      • modified residue (333)
      • modified residue (347)
      • modified residue (373)
    Domains in SCOPe 2.07: d1vl6d1, d1vl6d2, d1vl6d3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl6A (A:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6A (A:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl6B (B:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6B (B:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekvvv
    ngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnperlsgdl
    etalegadffigvsrkpewvifalanpvpelareagafivatgrsdhpnqvnnllafpgi
    mkgavekrskitknmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vl6C (C:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6C (C:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vl6D (D:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6D (D:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa