Lineage for d1vkdf_ (1vkd F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416839Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2416849Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2416980Family b.67.2.4: TM1225-like predicted glycosylases [110284] (2 proteins)
    Pfam PF04041 DUF377
  6. 2416981Protein Hypothetical protein TM1225 [110285] (1 species)
  7. 2416982Species Thermotoga maritima [TaxId:2336] [110286] (1 PDB entry)
    Uniprot Q9X0V2
  8. 2416988Domain d1vkdf_: 1vkd F: [108649]
    Other proteins in same PDB: d1vkda2
    Structural genomics target
    complexed with trs

Details for d1vkdf_

PDB Entry: 1vkd (more details), 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution
PDB Compounds: (F:) conserved hypothetical protein TM1225

SCOPe Domain Sequences for d1vkdf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vkdf_ b.67.2.4 (F:) Hypothetical protein TM1225 {Thermotoga maritima [TaxId: 2336]}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrnsm

SCOPe Domain Coordinates for d1vkdf_:

Click to download the PDB-style file with coordinates for d1vkdf_.
(The format of our PDB-style files is described here.)

Timeline for d1vkdf_: