SCOP 1.73: Domain d1vkde_: 1vkd E:

Lineage for d1vkde_ (1vkd E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
   consists of five 4-stranded beta-sheet motifs; meander

4. Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (5 families)

5. Family b.67.2.4: TM1225-like predicted glycosylases [110284] (1 protein)
   Pfam PF04041 DUF377

6. Protein Hypothetical protein TM1225 [110285] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110286] (1 PDB entry)

8. Domain d1vkde_: 1vkd E: [108648]

Details for d1vkde_

PDB Entry: 1vkd, 2.1 Å

PDB Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution

PDB Compounds: (E:) conserved hypothetical protein TM1225

SCOP Domain Sequences for d1vkde_:

Sequence; same for both SEQRES and ATOM records:

>d1vkde_ b.67.2.4 (E:) Hypothetical protein TM1225 {Thermotoga maritima [TaxId: 2336]}
mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
gaadthvalafgyideivdfvkrns

Timeline for d1vkde_:

• d1vkde_ first appeared in SCOP 1.69
  
• d1vkde_ appears in SCOP 1.71
  
• d1vkde_ appears in SCOP 1.75
  
• d1vkde_ appears in the current release, SCOPe 2.08