Lineage for d1vk8d_ (1vk8 D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1030227Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 1030228Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 1030244Protein Hypothetical protein TM0486 [110985] (1 species)
  7. 1030245Species Thermotoga maritima [TaxId:2336] [110986] (1 PDB entry)
    Uniprot Q9WYV6
  8. 1030249Domain d1vk8d_: 1vk8 D: [108639]
    Structural genomics target
    complexed with unl

Details for d1vk8d_

PDB Entry: 1vk8 (more details), 1.8 Å

PDB Description: crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution
PDB Compounds: (D:) hypothetical protein TM0486

SCOPe Domain Sequences for d1vk8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vk8d_ d.58.48.1 (D:) Hypothetical protein TM0486 {Thermotoga maritima [TaxId: 2336]}
pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela
ryleqfakrfvlqldidykaggitieekvskyr

SCOPe Domain Coordinates for d1vk8d_:

Click to download the PDB-style file with coordinates for d1vk8d_.
(The format of our PDB-style files is described here.)

Timeline for d1vk8d_: