Lineage for d1vgra_ (1vgr A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2493182Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2493183Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2493184Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 2493227Protein Formyl-CoA transferase [89798] (1 species)
  7. 2493228Species Oxalobacter formigenes [TaxId:847] [89799] (6 PDB entries)
    Uniprot O06644
  8. 2493231Domain d1vgra_: 1vgr A: [108625]
    complexed with coa; mutant

Details for d1vgra_

PDB Entry: 1vgr (more details), 2.1 Å

PDB Description: Formyl-CoA transferase mutant Asp169 to Glu
PDB Compounds: (A:) Formyl-coenzyme A transferase

SCOPe Domain Sequences for d1vgra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vgra_ c.123.1.1 (A:) Formyl-CoA transferase {Oxalobacter formigenes [TaxId: 847]}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgesnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOPe Domain Coordinates for d1vgra_:

Click to download the PDB-style file with coordinates for d1vgra_.
(The format of our PDB-style files is described here.)

Timeline for d1vgra_: