PDB entry 1vgr

View 1vgr on RCSB PDB site
Description: Formyl-CoA transferase mutant Asp169 to Glu
Class: transferase
Keywords: CoA transferase, oxalate, oxalate degradation, intertwined, knotted fold, CAIB-BAIF family, CoA complex, transferase
Deposited on 2004-04-28, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.184
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Formyl-coenzyme A transferase
    Species: OXALOBACTER FORMIGENES [TaxId:847]
    Gene: FRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06644 (0-426)
      • engineered (167)
      • see remark 999 (184)
    Domains in SCOPe 2.07: d1vgra_
  • Chain 'B':
    Compound: Formyl-coenzyme A transferase
    Species: OXALOBACTER FORMIGENES [TaxId:847]
    Gene: FRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06644 (0-426)
      • engineered (167)
      • see remark 999 (184)
    Domains in SCOPe 2.07: d1vgrb_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgrA (A:)
    tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
    mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
    asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgesnsgmhlmigil
    aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
    plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
    kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
    lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
    lhakqvv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vgrB (B:)
    tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
    mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
    asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgesnsgmhlmigil
    aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
    plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
    kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
    lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
    lhakqvv