![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily) unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432 |
![]() | Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) ![]() |
![]() | Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins) |
![]() | Protein Calcium ATPase [81658] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (42 PDB entries) Uniprot P04191 |
![]() | Domain d1vfpa3: 1vfp A:361-599 [108578] Other proteins in same PDB: d1vfpa1, d1vfpa2, d1vfpa4, d1vfpb1, d1vfpb2, d1vfpb4 complexed with acp, ca, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1vfp (more details), 2.9 Å
SCOPe Domain Sequences for d1vfpa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfpa3 d.220.1.1 (A:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm
Timeline for d1vfpa3:
![]() Domains from other chains: (mouse over for more information) d1vfpb1, d1vfpb2, d1vfpb3, d1vfpb4 |