Lineage for d1vfpb3 (1vfp B:361-599)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564091Fold d.220: Metal cation-transporting ATPase, ATP-binding domain N [81661] (1 superfamily)
    unusual fold; core: beta-alpha(2)-beta(3)-alpha(2)-beta(2); 6-stranded antiparallel beta-sheet, order: 165432
  4. 2564092Superfamily d.220.1: Metal cation-transporting ATPase, ATP-binding domain N [81660] (1 family) (S)
  5. 2564093Family d.220.1.1: Metal cation-transporting ATPase, ATP-binding domain N [81659] (4 proteins)
  6. 2564094Protein Calcium ATPase [81658] (1 species)
  7. 2564095Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81657] (43 PDB entries)
    Uniprot P04191
  8. 2564135Domain d1vfpb3: 1vfp B:361-599 [108582]
    Other proteins in same PDB: d1vfpa1, d1vfpa2, d1vfpa4, d1vfpb1, d1vfpb2, d1vfpb4
    complexed with acp, ca, mg

Details for d1vfpb3

PDB Entry: 1vfp (more details), 2.9 Å

PDB Description: Crystal structure of the SR CA2+-ATPase with bound AMPPCP
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d1vfpb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfpb3 d.220.1.1 (B:361-599) Calcium ATPase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
msvckmfiidkvdgdfcslnefsitgstyapegevlkndkpirsgqfdglvelaticalc
ndssldfnetkgvyekvgeatetalttlvekmnvfntevrnlskveranacnsvirqlmk
keftlefsrdrksmsvycspakssraavgnkmfvkgapegvidrcnyvrvgttrvpmtgp
vkekilsvikewgtgrdtlrclalatrdtppkreemvlddssrfmeyetdltfvgvvgm

SCOPe Domain Coordinates for d1vfpb3:

Click to download the PDB-style file with coordinates for d1vfpb3.
(The format of our PDB-style files is described here.)

Timeline for d1vfpb3: