Class a: All alpha proteins [46456] (226 folds) |
Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily) multihelical; can be divided into three subdomains (neck, body and tail) |
Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family) the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like |
Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins) the 'neck' domain corresponds to the C-terminal part of Pfam 01743 |
Protein Poly A polymerase PcnB [109961] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [109962] (1 PDB entry) |
Domain d1vfgb1: 1vfg B:137-351 [108572] Other proteins in same PDB: d1vfga2, d1vfgb2 complexed with apc |
PDB Entry: 1vfg (more details), 2.8 Å
SCOP Domain Sequences for d1vfgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfgb1 a.173.1.1 (B:137-351) Poly A polymerase PcnB {Aquifex aeolicus} virvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlinei klalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridy gwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkakenyevyrl lkplhtsvllllmleeelkekiklyleklrkvklp
Timeline for d1vfgb1: