SCOP 1.71: Domain d1vfga1: 1vfg A:137-351

Lineage for d1vfga1 (1vfg A:137-351)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
   the 'neck' domain corresponds to the C-terminal part of Pfam 01743

6. Protein Poly A polymerase PcnB [109961] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [109962] (1 PDB entry)

8. Domain d1vfga1: 1vfg A:137-351 [108570]
   Other proteins in same PDB: d1vfga2, d1vfgb2

Details for d1vfga1

PDB Entry: 1vfg, 2.8 Å

PDB Description: Crystal structure of tRNA nucleotidyltransferase complexed with a primer tRNA and an incoming ATP analog

SCOP Domain Sequences for d1vfga1:

Sequence; same for both SEQRES and ATOM records:

>d1vfga1 a.173.1.1 (A:137-351) Poly A polymerase PcnB {Aquifex aeolicus}
virvlhpvsfiedpvrilralrfagrlnfklsrstekllkqavnlgllkeaprgrlinei
klalredrfleilelyrkyrvleeiiegfqwnekvlqklyalrkvvdwhalefseeridy
gwlyllilisnldyergkhfleemsapswvretykfmkfklgslkeelkkakenyevyrl
lkplhtsvllllmleeelkekiklyleklrkvklp

Timeline for d1vfga1:

• d1vfga1 first appeared in SCOP 1.69
  
• d1vfga1 appears in SCOP 1.73
  
• d1vfga1 appears in the current release, SCOPe 2.08