Lineage for d1vesb_ (1ves B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289734Protein Novel antigen receptor 12Y-2 [110046] (1 species)
  7. 1289735Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [110047] (1 PDB entry)
    Uniprot Q6X1E6 # fragment
  8. 1289737Domain d1vesb_: 1ves B: [108552]

Details for d1vesb_

PDB Entry: 1ves (more details), 2.18 Å

PDB Description: Structure of New Antigen Receptor variable domain from sharks
PDB Compounds: (B:) new antigen receptor variable domain

SCOPe Domain Sequences for d1vesb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vesb_ b.1.1.1 (B:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
kgsksfslrisdlrvedsgtykcqafyslplgdynysllfrgekgagtaltvk

SCOPe Domain Coordinates for d1vesb_:

Click to download the PDB-style file with coordinates for d1vesb_.
(The format of our PDB-style files is described here.)

Timeline for d1vesb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vesa_