Lineage for d1vesb_ (1ves B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Novel antigen receptor 12Y-2 [110046] (1 species) Species Spotted wobbegong (Orectolobus maculatus) [TaxId:168098] [110047] (1 PDB entry)
Uniprot Q6X1E6 # fragment
Domain d1vesb_: 1ves B: [108552]
Details for d1vesb_
PDB Entry: 1ves (more details), 2.18 Å
PDB Description: Structure of New Antigen Receptor variable domain from sharks
PDB Compounds: (B:) new antigen receptor variable domainSCOPe Domain Sequences for d1vesb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vesb_ b.1.1.1 (B:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]}
awvdqtprtatketgesltincvlrdasfelkdtgwyrtklgstneqsisiggryvetvn
kgsksfslrisdlrvedsgtykcqafyslplgdynysllfrgekgagtaltvk
SCOPe Domain Coordinates for d1vesb_:
Click to download the PDB-style file with coordinates for d1vesb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vesb_:
- d1vesb_ first appeared in SCOP 1.69
- d1vesb_ appears in SCOPe 2.07
View in 3D
