SCOP 1.75: Domain d1vcoa2: 1vco A:11-282

Lineage for d1vcoa2 (1vco A:11-282)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (15 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein CTP synthase PyrG, N-terminal domain [110551] (3 species)

7. Species Thermus thermophilus [TaxId:274] [110553] (3 PDB entries)
   Uniprot Q5SIA8

8. Domain d1vcoa2: 1vco A:11-282 [108509]
   Other proteins in same PDB: d1vcoa1
   complexed with gln

Details for d1vcoa2

PDB Entry: 1vco, 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 CTP synthetase complex with Glutamine

PDB Compounds: (A:) CTP synthetase

SCOP Domain Sequences for d1vcoa2:

Sequence; same for both SEQRES and ATOM records:

>d1vcoa2 c.37.1.10 (A:11-282) CTP synthase PyrG, N-terminal domain {Thermus thermophilus [TaxId: 274]}
prkyvfitggvvsslgkgiltsslgallrargyrvtaikidpyvnvdagtmrpyehgevf
vtadgaetdldighyerfldmdlsrgnnlttgqvylsviqkerrgeylsqtvqviphitd
eikerirkvaeeqkaeivvvevggtvgdieslpfleairqfrfdegegntlylhltlvpy
letseefktkptqhsvatlrgvgiqpdilvlrsarpvpeevrrkvalftnvrpghvfssp
tvehlyevpllleeqglgraveralgleavip

Timeline for d1vcoa2:

• d1vcoa2 first appeared in SCOP 1.69
  
• d1vcoa2 appears in SCOP 1.73
  
• d1vcoa2 appears in SCOPe 2.01
  
• d1vcoa2 appears in the current release, SCOPe 2.08