Lineage for d1vcoa1 (1vco A:298-547)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481897Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (6 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 481898Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (9 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 481951Protein CTP synthase PyrG, C-terminal domain [110481] (2 species)
  7. 481955Species Thermus thermophilus [TaxId:274] [110483] (3 PDB entries)
  8. 481956Domain d1vcoa1: 1vco A:298-547 [108508]
    Other proteins in same PDB: d1vcoa2

Details for d1vcoa1

PDB Entry: 1vco (more details), 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 CTP synthetase complex with Glutamine

SCOP Domain Sequences for d1vcoa1:

Sequence, based on SEQRES records: (download)

>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus}
ertvkiaiagkyvkmpdaylsllealrhagiknrarvevkwvdaesleaadleeafrdvs
gilvpggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefd
phtphpvidlmpeqleveglggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnp
lyvdgleraglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfv
gfveaalayq

Sequence, based on observed residues (ATOM records): (download)

>d1vcoa1 c.23.16.1 (A:298-547) CTP synthase PyrG, C-terminal domain {Thermus thermophilus}
ertvkiaiagkyvdaylsllealrhagiknrarvevkwvdaesladleeafrdvsgilvp
ggfgvrgiegkvraaqyarerkipylgiclglqiaviefarnvaglkganstefdphtph
pvidlmpeqlevggtmrlgdwpmrikpgtllhrlygkeevlerhrhryevnplyvdgler
aglvvsattpgmrgrgaglveaielkdhpfflglqshpefksrpmrpsppfvgfveaala
yq

SCOP Domain Coordinates for d1vcoa1:

Click to download the PDB-style file with coordinates for d1vcoa1.
(The format of our PDB-style files is described here.)

Timeline for d1vcoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vcoa2