Lineage for d1vbfa_ (1vbf A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2500829Family c.66.1.7: Protein-L-isoaspartyl O-methyltransferase [53354] (1 protein)
    topological variant; strand order 3214567; strand 6 is antiparallel to the rest
    automatically mapped to Pfam PF01135
  6. 2500830Protein Protein-L-isoaspartyl O-methyltransferase [68927] (5 species)
  7. 2500842Species Sulfolobus tokodaii [TaxId:111955] [110668] (1 PDB entry)
    Uniprot Q972K9
  8. 2500843Domain d1vbfa_: 1vbf A: [108475]

Details for d1vbfa_

PDB Entry: 1vbf (more details), 2.8 Å

PDB Description: Crystal structure of protein L-isoaspartate O-methyltransferase homologue from Sulfolobus tokodaii
PDB Compounds: (A:) 231aa long hypothetical protein-L-isoaspartate O-methyltransferase

SCOPe Domain Sequences for d1vbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]}
asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgi
fmldeldlhkgqkvleigtgigyytaliaeivdkvvsveinekmynyaskllsyynnikl
ilgdgtlgyeeekpydrvvvwataptllckpyeqlkeggimilpigvgrvqklykvikkg
nspslenlgevmfgrigglygfyddyddiefrvnklerqiksil

SCOPe Domain Coordinates for d1vbfa_:

Click to download the PDB-style file with coordinates for d1vbfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vbfa_: