Lineage for d1va5a_ (1va5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900132Family c.69.1.3: Mycobacterial antigens [53491] (5 proteins)
    automatically mapped to Pfam PF00756
  6. 2900142Protein Antigen 85c [53494] (1 species)
  7. 2900143Species Mycobacterium tuberculosis [TaxId:1773] [53495] (3 PDB entries)
    Uniprot P31953
  8. 2900147Domain d1va5a_: 1va5 A: [108464]
    complexed with sog

Details for d1va5a_

PDB Entry: 1va5 (more details), 2.02 Å

PDB Description: antigen 85c with octylthioglucoside in active site
PDB Compounds: (A:) Antigen 85-C

SCOPe Domain Sequences for d1va5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va5a_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d1va5a_:

Click to download the PDB-style file with coordinates for d1va5a_.
(The format of our PDB-style files is described here.)

Timeline for d1va5a_: