SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1va5a_ (1va5 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134548Family c.69.1.3: Mycobacterial antigens [53491] (5 protein domains)
    automatically mapped to Pfam PF00756
  6. 2134558Protein Antigen 85c [53494] (1 species)
  7. 2134559Species Mycobacterium tuberculosis [TaxId:1773] [53495] (3 PDB entries)
    Uniprot P31953
  8. 2134563Domain d1va5a_: 1va5 A: [108464]
    complexed with sog

Details for d1va5a_

PDB Entry: 1va5 (more details), 2.02 Å

PDB Description: Antigen 85C with octylthioglucoside in active site
PDB Compounds: (A:) Antigen 85-C

SCOPe Domain Sequences for d1va5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1va5a_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]}
mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d1va5a_:

Click to download the PDB-style file with coordinates for d1va5a_.
(The format of our PDB-style files is described here.)

Timeline for d1va5a_: