PDB entry 1va5

View 1va5 on RCSB PDB site
Description: Antigen 85C with octylthioglucoside in active site
Class: transferase
Keywords: alpha-beta hydrolase, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, transferase
Deposited on 2004-02-11, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: 0.187
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antigen 85-C
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fbpC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4V4 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1va5a_
  • Chain 'B':
    Compound: Antigen 85-C
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fbpC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A4V4 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1va5b_
  • Heterogens: SOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1va5A (A:)
    mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
    yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
    avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
    pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
    dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaalghhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va5A (A:)
    mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
    yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
    avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
    pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
    dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1va5B (B:)
    mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
    yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
    avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
    pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
    dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlngatppaapaapaalghhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1va5B (B:)
    mfsrpglpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeey
    yqsglsvimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgna
    avglsmsggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwg
    pssdpawkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfr
    dtyaadggrngvfnfppngthswpywneqlvamkadiqhvlng