Lineage for d1v9wa_ (1v9w A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 487332Family c.47.1.16: Txnl5-like (Pfam 06110) [110612] (1 protein)
  6. 487333Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species)
  7. 487336Species Mouse (Mus musculus) [TaxId:10090] [110614] (1 PDB entry)
  8. 487337Domain d1v9wa_: 1v9w A: [108453]
    Structural genomics target

Details for d1v9wa_

PDB Entry: 1v9w (more details)

PDB Description: solution structure of mouse putative 42-9-9 protein

SCOP Domain Sequences for d1v9wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9wa_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Mouse (Mus musculus)}
gsegaatmatfeevsvlgfeefdkavkehesktifayfsgskdtegkswcpdcveaepvi
reglkhvtedcvfiycqvgdkpywkdpnndfrqklkitavptllkygtpqklveseccqs
slvemifsed

SCOP Domain Coordinates for d1v9wa_:

Click to download the PDB-style file with coordinates for d1v9wa_.
(The format of our PDB-style files is described here.)

Timeline for d1v9wa_: