Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.16: Txnl5-like (Pfam 06110) [110612] (1 protein) |
Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [110614] (1 PDB entry) |
Domain d1v9wa_: 1v9w A: [108453] Structural genomics target |
PDB Entry: 1v9w (more details)
SCOP Domain Sequences for d1v9wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v9wa_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Mouse (Mus musculus)} gsegaatmatfeevsvlgfeefdkavkehesktifayfsgskdtegkswcpdcveaepvi reglkhvtedcvfiycqvgdkpywkdpnndfrqklkitavptllkygtpqklveseccqs slvemifsed
Timeline for d1v9wa_: