Lineage for d1v9wa1 (1v9w A:8-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878861Family c.47.1.16: Txnl5-like [110612] (1 protein)
    Pfam PF06110
  6. 2878862Protein Putative 42-9-9 protein (thioredoxin containing protein Txnl5) [110613] (2 species)
  7. 2878865Species Mouse (Mus musculus) [TaxId:10090] [110614] (1 PDB entry)
    Uniprot Q9D0Y4
  8. 2878866Domain d1v9wa1: 1v9w A:8-130 [108453]
    Other proteins in same PDB: d1v9wa2
    Structural genomics target

Details for d1v9wa1

PDB Entry: 1v9w (more details)

PDB Description: solution structure of mouse putative 42-9-9 protein
PDB Compounds: (A:) putative 42-9-9 protein

SCOPe Domain Sequences for d1v9wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v9wa1 c.47.1.16 (A:8-130) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Mouse (Mus musculus) [TaxId: 10090]}
matfeevsvlgfeefdkavkehesktifayfsgskdtegkswcpdcveaepvireglkhv
tedcvfiycqvgdkpywkdpnndfrqklkitavptllkygtpqklveseccqsslvemif
sed

SCOPe Domain Coordinates for d1v9wa1:

Click to download the PDB-style file with coordinates for d1v9wa1.
(The format of our PDB-style files is described here.)

Timeline for d1v9wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v9wa2