Class b: All beta proteins [48724] (144 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.4: Ribosomal L27 protein [110324] (1 family) rudiment single hybrid fold with a permuted topology |
Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein) Pfam 01016; different |
Protein TT0826 [110326] (1 species) |
Species Thermus thermophilus [TaxId:274] [110327] (1 PDB entry) |
Domain d1v8qb_: 1v8q B: [108429] |
PDB Entry: 1v8q (more details), 2.8 Å
SCOP Domain Sequences for d1v8qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8qb_ b.84.4.1 (B:) TT0826 {Thermus thermophilus} rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv hvrpla
Timeline for d1v8qb_: