Lineage for d1v8qb_ (1v8q B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471225Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 471365Superfamily b.84.4: Ribosomal L27 protein [110324] (1 family) (S)
    rudiment single hybrid fold with a permuted topology
  5. 471366Family b.84.4.1: Ribosomal L27 protein [110325] (1 protein)
    Pfam 01016; different
  6. 471367Protein TT0826 [110326] (1 species)
  7. 471368Species Thermus thermophilus [TaxId:274] [110327] (1 PDB entry)
  8. 471370Domain d1v8qb_: 1v8q B: [108429]

Details for d1v8qb_

PDB Entry: 1v8q (more details), 2.8 Å

PDB Description: Crystal structure of ribosomal protein L27 from Thermus thermophilus HB8

SCOP Domain Sequences for d1v8qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8qb_ b.84.4.1 (B:) TT0826 {Thermus thermophilus}
rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
hvrpla

SCOP Domain Coordinates for d1v8qb_:

Click to download the PDB-style file with coordinates for d1v8qb_.
(The format of our PDB-style files is described here.)

Timeline for d1v8qb_: