PDB entry 1v8q

View 1v8q on RCSB PDB site
Description:
Deposited on 2004-01-13, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.197
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1v8qa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1v8qb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1v8qc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1v8qd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8qA (A:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8qA (A:)
    rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
    hvrpla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8qB (B:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8qB (B:)
    rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
    hvrpla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8qC (C:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8qC (C:)
    rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
    hvrpla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8qD (D:)
    mahkkglgstrngrdsqakrlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlf
    alvdgvvefqdrgrlgryvhvrpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8qD (D:)
    rlgvkryegqvvragnilvrqrgtrfkpgknvgmgrdftlfalvdgvvefqdrgrlgryv
    hvrpla