Lineage for d1v7pa_ (1v7p A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048333Protein Snake coagglutinin alpha chain [88861] (10 species)
    heterodimeric coagulation factors IX/X-binding protein (IX/X-BP)
  7. 1048363Species Snake (Echis multisquamatus), Ems16 [TaxId:93050] [103343] (2 PDB entries)
    Uniprot Q7T2Q1 24-157
  8. 1048364Domain d1v7pa_: 1v7p A: [108406]
    Other proteins in same PDB: d1v7pb_, d1v7pc_
    complexed with cl, mn, nag, po4

Details for d1v7pa_

PDB Entry: 1v7p (more details), 1.9 Å

PDB Description: structure of ems16-alpha2-i domain complex
PDB Compounds: (A:) EMS16 A chain

SCOPe Domain Sequences for d1v7pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7pa_ d.169.1.1 (A:) Snake coagglutinin alpha chain {Snake (Echis multisquamatus), Ems16 [TaxId: 93050]}
dfdcpsdwtaydqhcylaigepqnwyeaerfcteqakdghlvsiqsreegnfvaqlvsgf
mhrseiyvwiglrdrreeqqcnpewndgskiiyvnwkegeskmcqgltkwtnfhdwnnin
cedlypfvckfsav

SCOPe Domain Coordinates for d1v7pa_:

Click to download the PDB-style file with coordinates for d1v7pa_.
(The format of our PDB-style files is described here.)

Timeline for d1v7pa_: