Lineage for d1v57a1 (1v57 A:62-230)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698982Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 698983Superfamily c.47.1: Thioredoxin-like [52833] (22 families) (S)
  5. 699780Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (2 proteins)
    elaborated common fold
  6. 699794Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species)
  7. 699795Species Escherichia coli [TaxId:562] [110611] (5 PDB entries)
  8. 699800Domain d1v57a1: 1v57 A:62-230 [108367]
    Other proteins in same PDB: d1v57a2, d1v57b2

Details for d1v57a1

PDB Entry: 1v57 (more details), 2 Å

PDB Description: Crystal Structure of the Disulfide Bond Isomerase DsbG
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbG

SCOP Domain Sequences for d1v57a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v57a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]}
nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp
wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq
mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn

SCOP Domain Coordinates for d1v57a1:

Click to download the PDB-style file with coordinates for d1v57a1.
(The format of our PDB-style files is described here.)

Timeline for d1v57a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v57a2