![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
![]() | Protein Thiol:disulfide interchange protein DsbG, C-terminal domain [110610] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110611] (5 PDB entries) Uniprot P77202 |
![]() | Domain d1v57a1: 1v57 A:62-230 [108367] Other proteins in same PDB: d1v57a2, d1v57b2 complexed with so4 |
PDB Entry: 1v57 (more details), 2 Å
SCOPe Domain Sequences for d1v57a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v57a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} nlsntliekeiyapagremwqrmeqshwlldgkkdapvivyvfadpfcpyckqfwqqarp wvdsgkvqlrtllvgvikpespataaailaskdpaktwqqyeasggklklnvpanvsteq mkvlsdneklmddlganvtpaiyymskentlqqavglpdqktlniimgn
Timeline for d1v57a1: