Lineage for d1v2ba_ (1v2b A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533176Fold d.107: Mog1p/PsbP-like [55723] (1 superfamily)
    (beta-hairpin)-beta(3)-alpha-beta(4)-alpha; 3 layers: a/b/a; antiparallel beta-sheet of 7 strands; order: 1237654
  4. 2533177Superfamily d.107.1: Mog1p/PsbP-like [55724] (5 families) (S)
  5. 2533183Family d.107.1.2: PsbP-like [111092] (2 proteins)
    Pfam PF01789
  6. 2533184Protein Oxygen-evolving enhancer protein PsbP [111093] (1 species)
  7. 2533185Species Tobacco (Nicotiana tabacum) [TaxId:4097] [111094] (1 PDB entry)
    Uniprot P18212
  8. 2533186Domain d1v2ba_: 1v2b A: [108279]
    complexed with glc, so4

Details for d1v2ba_

PDB Entry: 1v2b (more details), 1.6 Å

PDB Description: crystal structure of psbp protein in the oxygen-evolving complex of photosystem ii from higher plants
PDB Compounds: (A:) 23-kDa polypeptide of photosystem II oxygen-evolving complex

SCOPe Domain Sequences for d1v2ba_:

Sequence, based on SEQRES records: (download)

>d1v2ba_ d.107.1.2 (A:) Oxygen-evolving enhancer protein PsbP {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
tdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkksitdfg
speqflsqvdyllgrqaysgktdseggfesdavaianvletstaevggkqyyylsiltrt
adgneggkhqlvtatvndgklyickaqagdkrwfkgakkfventatsfsla

Sequence, based on observed residues (ATOM records): (download)

>d1v2ba_ d.107.1.2 (A:) Oxygen-evolving enhancer protein PsbP {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
tdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkksitdfg
speqflsqvdyllavaianvletstaevggkqyyylsiltrtggkhqlvtatvndgklyi
ckaqagdkrwfkgakkfventatsfsla

SCOPe Domain Coordinates for d1v2ba_:

Click to download the PDB-style file with coordinates for d1v2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1v2ba_: