PDB entry 1v2b

View 1v2b on RCSB PDB site
Description: Crystal Structure of PsbP Protein in the Oxygen-Evolving Complex of Photosystem II from Higher Plants
Class: photosynthesis
Keywords: alpha-beta, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, PHOTOSYNTHESIS
Deposited on 2003-10-14, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 23-kDa polypeptide of photosystem II oxygen-evolving complex
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: psbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v2ba_
  • Chain 'B':
    Compound: 23-kDa polypeptide of photosystem II oxygen-evolving complex
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: psbp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v2bb_
  • Heterogens: GLC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v2bA (A:)
    gkpktdtdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkk
    sitdfgspeqflsqvdyllgrqaysgktdseggfesdavaianvletstaevggkqyyyl
    siltrtadgneggkhqlvtatvndgklyickaqagdkrwfkgakkfventatsfsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2bA (A:)
    tdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkksitdfg
    speqflsqvdyllavaianvletstaevggkqyyylsiltrtggkhqlvtatvndgklyi
    ckaqagdkrwfkgakkfventatsfsla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v2bB (B:)
    gkpktdtdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkk
    sitdfgspeqflsqvdyllgrqaysgktdseggfesdavaianvletstaevggkqyyyl
    siltrtadgneggkhqlvtatvndgklyickaqagdkrwfkgakkfventatsfsla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v2bB (B:)
    tdfqtyngdgfklqipskwnpnkeveypgqvlrfednfdatsnvivaitptdkksitdfg
    speqflsqvdyllgrvaianvletstaevggkqyyylsiltrtadggkhqlvtatvndgk
    lyickaqagdkrwfkgakkfventatsfsla