Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
Protein Branched-chain alpha-keto acid dehydrogenase, PP module [88767] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [88768] (19 PDB entries) Uniprot P12694 52-445 |
Domain d1v1ra_: 1v1r A: [108272] Other proteins in same PDB: d1v1rb1, d1v1rb2 complexed with cl, gol, k, na, so4 |
PDB Entry: 1v1r (more details), 1.8 Å
SCOPe Domain Sequences for d1v1ra_:
Sequence, based on SEQRES records: (download)
>d1v1ra_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} aefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtllntmdri lyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyplelfmaqc ygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrvvicyfge gaasegdahagfnfaatlecpiiffcrnngyaistptseqyrgdgiaargpgygimsirv dgndvfavynatkearrravaenqpflieamtyrighastsddssayrsvdevnywdkqd hpisrlrhyllsqgwwdeeqekawrkqsrrkvmeafeqaerkpkpnpnllfsdvyqempa qlrkqqeslarhlqtygehypldhfdk
>d1v1ra_ c.36.1.11 (A:) Branched-chain alpha-keto acid dehydrogenase, PP module {Human (Homo sapiens) [TaxId: 9606]} aefidklefiqpnvisgipiyrvmdrqgqiinpsedphlpkekvlklyksmtllntmdri lyesqrqgrisfymtnygeegthvgsaaaldntdlvfgqyreagvlmyrdyplelfmaqc ygnisdlgkgrqmpvhygckerhfvtissplatqipqavgaayaakrananrvvicyfge gaasegdahagfnfaatlecpiiffcrnnseqyrgdgiaargpgygimsirvdgndvfav ynatkearrravaenqpflieamtyhpisrlrhyllsqgwwdeeqekawrkqsrrkvmea feqaerkpkpnpnllfsdvyqempaqlrkqqeslarhlqtygehypldhfdk
Timeline for d1v1ra_: