Lineage for d1v10a2 (1v10 A:137-304)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. Protein Laccase, middle domain [418906] (5 species)
  7. Species Rigidoporus lignosus [TaxId:219653] [419314] (1 PDB entry)
    Uniprot Q6H9H7 22-515
  8. Domain d1v10a2: 1v10 A:137-304 [108225]
    Other proteins in same PDB: d1v10a1, d1v10a3
    complexed with cu

Details for d1v10a2

PDB Entry: 1v10 (more details), 1.7 Å

PDB Description: structure of rigidoporus lignosus laccase from hemihedrally twinned crystals
PDB Compounds: (A:) laccase

SCOPe Domain Sequences for d1v10a2:

Sequence, based on SEQRES records: (download)

>d1v10a2 b.6.1.3 (A:137-304) Laccase, middle domain {Rigidoporus lignosus [TaxId: 219653]}
ydvddastvitiadwyhslstvlfpnpnkappapdttlinglgrnsanpsagqlavvsvq
sgkryrfrivstscfpnyafsidghrmtvievdgvshqpltvdsltifagqrysvvvean
qavgnywiranpsngrngftgginsaifryqgaavaepttsqnsgtal

Sequence, based on observed residues (ATOM records): (download)

>d1v10a2 b.6.1.3 (A:137-304) Laccase, middle domain {Rigidoporus lignosus [TaxId: 219653]}
ydvddastvitiadwyhslstkappapdttlinglgrnsanpsagqlavvsvqsgkryrf
rivstscfpnyafsidghrmtvievdgvshqpltvdsltifagqrysvvveanqavgnyw
iranpsngrngftgginsaifryqgaavaepttsqnsgtal

SCOPe Domain Coordinates for d1v10a2 are not available.

Timeline for d1v10a2:

Domains from same chain:
(mouse over for more information)
d1v10a1, d1v10a3