SCOPe 2.07: Domain d1v0hx1: 1v0h X:2-249

Lineage for d1v0hx1 (1v0h X:2-249)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (15 PDB entries)
   Uniprot Q43758

8. Domain d1v0hx1: 1v0h X:2-249 [108205]
   Other proteins in same PDB: d1v0hx2
   complexed with hem, na, sha

Details for d1v0hx1

PDB Entry: 1v0h, 1.46 Å

PDB Description: ascobate peroxidase from soybean cytosol in complex with salicylhydroxamic acid

PDB Compounds: (X:) ascorbate peroxidase

SCOPe Domain Sequences for d1v0hx1:

Sequence; same for both SEQRES and ATOM records:

>d1v0hx1 a.93.1.1 (X:2-249) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
gksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgtik
hpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwts
nplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahqk
lselgfad

Timeline for d1v0hx1:

• d1v0hx1 first appeared in SCOP 1.69, called d1v0hx_
  
• d1v0hx1 appears in SCOPe 2.06
  
• d1v0hx1 appears in the current release, SCOPe 2.08