Lineage for d1uyma_ (1uym A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510439Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 510440Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 510441Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (1 protein)
  6. 510442Protein HSP90 [55876] (3 species)
  7. 510464Species Human (Homo sapiens) [TaxId:9606] [55878] (19 PDB entries)
  8. 510483Domain d1uyma_: 1uym A: [108148]

Details for d1uyma_

PDB Entry: 1uym (more details), 2.45 Å

PDB Description: human hsp90-beta with pu3 (9-butyl-8(3,4,5-trimethoxy-benzyl)-9h- purin-6-ylamine)

SCOP Domain Sequences for d1uyma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uyma_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens)}
evetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltdpskldsgke
lkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkvilhlkedqt
eyleerrvkevvkkhsqfigypitlyleker

SCOP Domain Coordinates for d1uyma_:

Click to download the PDB-style file with coordinates for d1uyma_.
(The format of our PDB-style files is described here.)

Timeline for d1uyma_: