| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) ![]() |
| Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) |
| Protein HSP90 [55876] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55878] (189 PDB entries) Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223 |
| Domain d1uyma_: 1uym A: [108148] complexed with pu3 |
PDB Entry: 1uym (more details), 2.45 Å
SCOPe Domain Sequences for d1uyma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uyma_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnasdaldkiryesltdpskldsgke
lkidiipnpqertltlvdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvvvitkhnddeqyawessaggsftvradhgepigrgtkvilhlkedqt
eyleerrvkevvkkhsqfigypitlyleker
Timeline for d1uyma_: