SCOPe 2.02: Domain d1uxib1: 1uxi B:2-143

Lineage for d1uxib1 (1uxi B:2-143)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (8 proteins)

6. Protein Malate dehydrogenase [51849] (12 species)

7. Species Chloroflexus aurantiacus [TaxId:1108] [69415] (7 PDB entries)
   Uniprot P80040

8. Domain d1uxib1: 1uxi B:2-143 [108110]
   Other proteins in same PDB: d1uxia2, d1uxib2
   complexed with fum, na, nad; mutant

Details for d1uxib1

PDB Entry: 1uxi, 2.1 Å

PDB Description: large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d1uxib1:

Sequence; same for both SEQRES and ATOM records:

>d1uxib1 c.2.1.5 (B:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
rkkisiigagfvgsttahwlaakelgdivlldivegvpqgkaldlyeaspiegfdvrvtg
tnnyadtansdvivvtsgaprkpgmsredlikvnaditracisqaaplspnaviimvnnp
ldamtylaaevsgfpkervigq

Timeline for d1uxib1:

• d1uxib1 first appeared in SCOP 1.69
  
• d1uxib1 appears in SCOPe 2.01
  
• d1uxib1 appears in SCOPe 2.03
  
• d1uxib1 appears in the current release, SCOPe 2.08