Lineage for d1uu0b_ (1uu0 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2502822Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2503100Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 2503108Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    Uniprot Q9X0D0
    TM1040
  8. 2503118Domain d1uu0b_: 1uu0 B: [108039]
    complexed with po4

Details for d1uu0b_

PDB Entry: 1uu0 (more details), 2.85 Å

PDB Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima (apo-form)
PDB Compounds: (B:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d1uu0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uu0b_ c.67.1.1 (B:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
ktylalnenpfpfpedlvdevfrrlnsdalriyydspdeeliekilsyldtdflsknnvs
vgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpltkdlripevnvgegd
vvfipnpnnptghvfereeierilktgafvaldeayyefhgesyvdflkkyenlavirtf
skafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakvaldhreifeertkfive
erermksalremgyritdsrgnfvfvfmekeekerllehlrtknvavrsfregvritigk
reendmilrelevfk

SCOPe Domain Coordinates for d1uu0b_:

Click to download the PDB-style file with coordinates for d1uu0b_.
(The format of our PDB-style files is described here.)

Timeline for d1uu0b_: