![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.6: Dr-family adhesin [110075] (1 protein) Pfam PF04619 |
![]() | Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110077] (7 PDB entries) Uniprot Q57254 P24093 23-159 |
![]() | Domain d1ut2c_: 1ut2 C: [108022] complexed with so4 |
PDB Entry: 1ut2 (more details), 3.3 Å
SCOPe Domain Sequences for d1ut2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ut2c_ b.2.3.6 (C:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]} gsftpsgttgttkltvteecqvrvgdltvaktrgqltdaapigpvtvqalgcnarqvalk adtdnfeqgkfflisdnnrdklyvnirpmdnsawttdngvfykndvgswggtigiyvdgq qtntppgnytltltggywa
Timeline for d1ut2c_: