Lineage for d1usqb_ (1usq B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 790053Family b.2.3.6: Dr-family adhesin [110075] (1 protein)
    Pfam PF04619
  6. 790054Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 790055Species Escherichia coli [TaxId:562] [110077] (7 PDB entries)
    Uniprot Q57254 P24093 23-159
  8. 790063Domain d1usqb_: 1usq B: [108006]

Details for d1usqb_

PDB Entry: 1usq (more details), 1.9 Å

PDB Description: complex of e. coli drae adhesin with chloramphenicol
PDB Compounds: (B:) dr hemagglutinin structural subunit

SCOP Domain Sequences for d1usqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usqb_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli [TaxId: 562]}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

SCOP Domain Coordinates for d1usqb_:

Click to download the PDB-style file with coordinates for d1usqb_.
(The format of our PDB-style files is described here.)

Timeline for d1usqb_: