Lineage for d1usqb_ (1usq B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 456653Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 456725Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 456829Family b.2.3.6: Dr-family adhesin (Pfam 04619) [110075] (1 protein)
  6. 456830Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species)
  7. 456831Species Escherichia coli [TaxId:562] [110077] (4 PDB entries)
  8. 456839Domain d1usqb_: 1usq B: [108006]

Details for d1usqb_

PDB Entry: 1usq (more details), 1.9 Å

PDB Description: complex of e. coli drae adhesin with chloramphenicol

SCOP Domain Sequences for d1usqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usqb_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli}
gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk
adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq
qtntppgnytltltggywa

SCOP Domain Coordinates for d1usqb_:

Click to download the PDB-style file with coordinates for d1usqb_.
(The format of our PDB-style files is described here.)

Timeline for d1usqb_: