Class b: All beta proteins [48724] (144 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) |
Family b.2.3.6: Dr-family adhesin (Pfam 04619) [110075] (1 protein) |
Protein DraA/Afimbrial adhesin Afa-III [110076] (1 species) |
Species Escherichia coli [TaxId:562] [110077] (4 PDB entries) |
Domain d1usqb_: 1usq B: [108006] |
PDB Entry: 1usq (more details), 1.9 Å
SCOP Domain Sequences for d1usqb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1usqb_ b.2.3.6 (B:) DraA/Afimbrial adhesin Afa-III {Escherichia coli} gsftpsgttgttkltvtekcqvrvgdltvaktrgqltdaapigpvtvqalgcdarqvalk adtdnfeqgkfflisdnnrdklyvnirptdnsawttdngvfykndvgswggiigiyvdgq qtntppgnytltltggywa
Timeline for d1usqb_: