SCOP 1.73: Domain d1usba1: 1usb A:81-219

Lineage for d1usba1 (1usb A:81-219)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (17 PDB entries)

8. Domain d1usba1: 1usb A:81-219 [108001]
   Other proteins in same PDB: d1usba2, d1usbb2

Details for d1usba1

PDB Entry: 1usb, 2.07 Å

PDB Description: rational design of a novel enzyme - efficient thioester hydrolysis enabled by the incorporation of a single his residue into human glutathione transferase a1-1

PDB Compounds: (A:) glutathione s-transferase a1

SCOP Domain Sequences for d1usba1:

Sequence; same for both SEQRES and ATOM records:

>d1usba1 a.45.1.1 (A:81-219) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleehrki

Timeline for d1usba1:

• d1usba1 first appeared in SCOP 1.69
  
• d1usba1 appears in SCOP 1.71
  
• d1usba1 appears in SCOP 1.75
  
• d1usba1 appears in the current release, SCOPe 2.08