Lineage for d1usba1 (1usb A:81-219)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 443394Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 443395Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 443396Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 443407Protein Class alpha GST [81349] (8 species)
  7. 443417Species Human (Homo sapiens), (a1-1) [TaxId:9606] [47625] (15 PDB entries)
  8. 443434Domain d1usba1: 1usb A:81-219 [108001]
    Other proteins in same PDB: d1usba2, d1usbb2

Details for d1usba1

PDB Entry: 1usb (more details), 2.07 Å

PDB Description: rational design of a novel enzyme - efficient thioester hydrolysis enabled by the incorporation of a single his residue into human glutathione transferase a1-1

SCOP Domain Sequences for d1usba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1usba1 a.45.1.1 (A:81-219) Class alpha GST {Human (Homo sapiens), (a1-1)}
lygkdikeralidmyiegiadlgemilllpvcppeekdaklalikekiknryfpafekvl
kshgqdylvgnklsradihlvellyyveeldsslissfpllkalktrisnlptvkkflqp
gsprkppmdeksleehrki

SCOP Domain Coordinates for d1usba1:

Click to download the PDB-style file with coordinates for d1usba1.
(The format of our PDB-style files is described here.)

Timeline for d1usba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1usba2